The Vega Science Trust`s extensive collection of science videos include lectures, discussions, interviews, Nobel Prize interviews, careers profiles, educational resources, and research news.

Sponsored Links
2.67 Rating by ClearWebStats

This website has a #1,787,495 rank in global traffic. It has a .org.uk as an domain extension. This website has a Google PageRank of 6 out of 10. This domain is estimated value of $ 480.00 and has a daily earning of $ 2.00. It is also listed in Dmoz. While no active threats were reported recently by users, vega.org.uk is SAFE to browse.

Get Custom Widget

Traffic Report for vega.org.uk

Daily Unique Visitors: 269
Daily Pageviews: 538

Estimated Valuation

Income Per Day: $ 2.00
Estimated Worth: $ 480.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: 560

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Good
WOT Privacy: Good
WOT Child Safety: Excellent

Website Ranks & Scores

Google Pagerank:
Alexa Rank: 1,787,495
Domain Authority: Not Applicable
DMOZ Listing: Yes
Google Pagerank
PR 6 out of 10
PageSpeed Score
77
Siteadvisor Rating
Not Applicable

Where is vega.org.uk server located?

Hosted IP Address:

139.184.80.33

Hosted Country:

United Kingdom GB

Location Latitude:

50.8284

Location Longitude:

-0.13947
vega.org.uk search engine traffic

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): 44
Linkedin Shares: 2
Delicious Shares: Not Applicable
Google+: 5

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 23
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Date: Tue, 28 Oct 2014 07:12:05 GMT
Server: Apache/2.0.52 (CentOS) mod_perl/1.99_16 Perl/v5.8.5 DAV/2 PHP/4.3.9 mod_python/3.1.3 Python/2.3.4 mod_ssl/2.0.52 OpenSSL/0.9.7a
X-Powered-By: PHP/4.3.9
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Nameserver Information

Host IP Address Country
ns.hosteurope.com 212.67.202.2 United Kingdom United Kingdom
ns2.hosteurope.com 62.138.132.22 Germany Germany

DNS Record Analysis

Host Type TTL Extra
vega.org.uk A 14399 IP: 139.184.80.33
vega.org.uk NS 14399 Target: ns.hosteurope.com
vega.org.uk NS 14399 Target: ns2.hosteurope.com
vega.org.uk SOA 14399 MNAME: ns.hosteurope.com
RNAME: hostmaster.vega.org.uk
Serial: 2012030808
Refresh: 86400
Retry: 3600
Expire: 1209600
vega.org.uk MX 14399 Priority: 20
Target: mx1.123-reg.co.uk
vega.org.uk MX 14399 Priority: 10
Target: mx0.123-reg.co.uk

Similarly Ranked Websites to vega.org.uk

Home | SR Tech Services - UAE

- srtechs.net

SR Tech Services is a company established in UAE providing installation, renovation and maintenance services on Elevators, Escalators, Central A/c and Automatic doors.

  1,787,503   $ 480.00

Homebrew Equipment Deals

- homebrewequipmentdeals.com

Find the best home brewing supplies and the best gifts for beer lovers.

  1,787,508   $ 480.00

WordPress.com — Buradan Ücretsiz bir Blog alın

- kocaelizmitsatilikarsadairevfiyatlari.wordpress.com

sahibinden satılık kocaeli izmit arsa, daire, konut, ev, villa, yat, tekne fiyatları başiskele, çayırova, darıca, derince, dilovası, gebze, gölcük, izmit, kandıra, karamürsel,...

  1,787,508   $ 480.00

Buy Handmade Shoes,Bags,Accessories Online for Men & Women | Kethini

- kethini.com

Kethini,makers of hand made shoes,bags,accessories for men & women,aims to cater the young urban Indian consumer needs by offering the highest quality stuff with innovative...

  1,787,508   $ 480.00

MediaGamma

- mediagamma.com

  1,787,509   $ 480.00

Competitive search data from SEMrush

vega.org.uk search engine traffic graph

Alexa Traffic Rank

Alexa Search Engine Traffic

Like vega.org.uk ? Comment / rate / feedback below