Web stats for Vega - vega.org.uk
The Vega Science Trust`s extensive collection of science videos include lectures, discussions, interviews, Nobel Prize interviews, careers profiles, educational resources, and research news.
Traffic Report of Vega
| Daily Unique Visitors: | 269 |
| Daily Pageviews: | 538 |
Estimated Valuation
| Income Per Day: | $ 2.00 |
| Estimated Worth: | $ 480.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Yahoo Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
| Alexa BackLinks: | 560 |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | Not Applicable |
| WOT Trustworthiness: |
 Good
|
| WOT Privacy: |
Good
|
| WOT Child Safety: |
 Excellent
|
Website Ranks & Scores
| Google Pagerank: |
|
| Alexa Rank: | 1,787,495 |
| Domain Authority: | Not Applicable |
PageSpeed Score
Siteadvisor Rating
Not Applicable
Where is vega.org.uk server located?
Hosted IP Address:
139.184.80.33
Hosted Country:
GB
Location Latitude:
50.8284Location Longitude:
-0.13947Social Engagement
| Facebook Shares: | Not Applicable |
| Facebook Likes: | Not Applicable |
| Facebook Comments: | Not Applicable |
| Twitter Count (Tweets): | 44 |
| Linkedin Shares: | 2 |
| Delicious Shares: | Not Applicable |
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | 1 |
| H3 Headings: | Not Applicable | H4 Headings: | Not Applicable |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | Not Applicable | Total Images: | 23 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
HTTP Header Analysis
Status-Code: 200
Status: 200 OK
Date: Tue, 28 Oct 2014 07:12:05 GMT
Server: Apache/2.0.52 (CentOS) mod_perl/1.99_16 Perl/v5.8.5 DAV/2 PHP/4.3.9 mod_python/3.1.3 Python/2.3.4 mod_ssl/2.0.52 OpenSSL/0.9.7a
X-Powered-By: PHP/4.3.9
Connection: close
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns.hosteurope.com |
|
212.67.202.2 |
 Germany
|
| ns2.hosteurope.com |
|
62.138.132.22 |
Germany
|
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| vega.org.uk | A | 14399 |
IP:139.184.80.33 |
| vega.org.uk | NS | 14399 |
Target:ns.hosteurope.com |
| vega.org.uk | NS | 14399 |
Target:ns2.hosteurope.com |
| vega.org.uk | SOA | 14399 |
MNAME:ns.hosteurope.com RNAME:hostmaster.vega.org.uk Serial:2012030808 Refresh:86400 Retry:3600 Expire:1209600 |
| vega.org.uk | MX | 14399 |
Priority:20 Target:mx1.123-reg.co.uk |
| vega.org.uk | MX | 14399 |
Priority:10 Target:mx0.123-reg.co.uk |
Similarly Ranked Websites to Vega
Home | SR Tech Services - UAE
SR Tech Services is a company established in UAE providing installation, renovation and maintenance services on Elevators, Escalators, Central A/c and Automatic doors.
1,787,503 
$ 480.00
Homebrew Equipment Deals
Find the best home brewing supplies and the best gifts for beer lovers.
1,787,508 $ 480.00
WordPress.com — Buradan Ücretsiz bir Blog alın
- kocaelizmitsatilikarsadairevfiyatlari.wordpress.com
sahibinden satılık kocaeli izmit arsa, daire, konut, ev, villa, yat, tekne fiyatları başiskele, çayırova, darıca, derince, dilovası, gebze, gölcük, izmit, kandıra, karamürsel, kartepe, körfez bulabilirsiniz.
1,787,508 $ 480.00
Buy Handmade Shoes,Bags,Accessories Online for Men & Women | Kethini
Kethini,makers of hand made shoes,bags,accessories for men & women,aims to cater the young urban Indian consumer needs by offering the highest quality stuff with innovative material and fresh new designs.
1,787,508 $ 480.00